(data stored in ACNUC7421 zone)

EMBL: CP001622.PE343

CP001622.PE343       Location/Qualifiers
FT   CDS             complement(354145..355095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0344"
FT                   /product="surface presentation of antigens (SPOA) protein"
FT                   /note="PFAM: surface presentation of antigens (SPOA)
FT                   protein; KEGG: rec:RHECIAT_CH0000730 flagellar C-ring motor
FT                   switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54655"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D6"
FT                   /inference="protein motif:PFAM:PF01052"
FT                   /protein_id="ACS54655.1"
FT                   /translation="MTMSNASHDKPAMDPALLAKLTGGLGDRGGVAKICSSFGEIYSEF
FT                   FPDVIKSETGLDVTVNYLGCEIGYKNHLIEDLSANVTLVDATLRNWSQNITLACGNGFV
FT                   ITLMEHLLGATADTIEEPADRLLSIIELDLAVMVFDKIAKVLRSAVNAPGGFEPSLSAP
FT                   HALDARARPPEDRPDEFAAAINMSITLAGIVSEFALIVPQTALLKTKVTPPKPKRQATG
FT                   KSPEWTEQLGDQVRRSHVTLEAKIRLQDLTLRTISKLMVGDVIPFRDHGDVRVEVSANS
FT                   KELYVCEFGRSGENYMVRVKDTMNSDDELIRHLMN"
     MTMSNASHDK PAMDPALLAK LTGGLGDRGG VAKICSSFGE IYSEFFPDVI KSETGLDVTV        60
     NYLGCEIGYK NHLIEDLSAN VTLVDATLRN WSQNITLACG NGFVITLMEH LLGATADTIE       120
     EPADRLLSII ELDLAVMVFD KIAKVLRSAV NAPGGFEPSL SAPHALDARA RPPEDRPDEF       180
     AAAINMSITL AGIVSEFALI VPQTALLKTK VTPPKPKRQA TGKSPEWTEQ LGDQVRRSHV       240
     TLEAKIRLQD LTLRTISKLM VGDVIPFRDH GDVRVEVSAN SKELYVCEFG RSGENYMVRV       300
     KDTMNSDDEL IRHLMN                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page