(data stored in ACNUC7421 zone)

EMBL: CP001622.PE344

CP001622.PE344       Location/Qualifiers
FT   CDS             complement(355096..355968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0345"
FT                   /product="chemotaxis motility protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000731 chemotaxis motility
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54656"
FT                   /db_xref="GOA:C6B1D7"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D7"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000731"
FT                   /protein_id="ACS54656.1"
FT                   /translation="MNIIIGFIVTCGCIVGSFMAMGGEVDALFQPFEFLIIGGAGLGSF
FT                   IMANPMKVVKDSGKALSEAFRHAVPKERNYLDTLGVLYSLMRDLRTKSRNEIEAHIDNP
FT                   AESTIFQSAPTVLKNKELTAFICDYVRLIIIGNARSHEIEALMDEELNTIMHDKMKPYH
FT                   SIQIMSDSFPAIGIVAAVLGVIKAMAHINDSPEVLGHLIGSALVGTFLGILLSYCVCSP
FT                   LVSQIKVVRNKQHRLYVIVKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMM
FT                   NPGGENKAA"
     MNIIIGFIVT CGCIVGSFMA MGGEVDALFQ PFEFLIIGGA GLGSFIMANP MKVVKDSGKA        60
     LSEAFRHAVP KERNYLDTLG VLYSLMRDLR TKSRNEIEAH IDNPAESTIF QSAPTVLKNK       120
     ELTAFICDYV RLIIIGNARS HEIEALMDEE LNTIMHDKMK PYHSIQIMSD SFPAIGIVAA       180
     VLGVIKAMAH INDSPEVLGH LIGSALVGTF LGILLSYCVC SPLVSQIKVV RNKQHRLYVI       240
     VKQTLLAYMN GSVPQVALEY GRKTISAYER PSIDAVEQEM MNPGGENKAA                  290
//

If you have problems or comments...

PBIL Back to PBIL home page