(data stored in ACNUC7421 zone)

EMBL: CP001622.PE345

CP001622.PE345       Location/Qualifiers
FT   CDS             356223..356957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0346"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgF;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: ret:RHE_CH00655
FT                   flagellar basal body rod protein FlgF"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54657"
FT                   /db_xref="GOA:C6B1D8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D8"
FT                   /inference="protein motif:TFAM:TIGR02490"
FT                   /protein_id="ACS54657.1"
FT                   /translation="MQSGLYVSLSSQMALEKRLNTIADNMANVNTTGFRATEVKFDEMV
FT                   AATKNKLNTKVAFVSQGNDYLNEGNGELQHTGNMLDFAIKGDAWFALDTPAGRVLTRDG
FT                   RFTIKDTGELVSIRGYPVLDAGGAPIQLNTKGGEPAVGTDGIIYQADRQVASLGLFEAD
FT                   ISKGYLRYENSGIMTTDQPRAVVDRFNVGVEQGYLENSNVNAMREITQLIEVNRAFESV
FT                   SSLMRDSEDSFKEAVQTLGGSR"
     MQSGLYVSLS SQMALEKRLN TIADNMANVN TTGFRATEVK FDEMVAATKN KLNTKVAFVS        60
     QGNDYLNEGN GELQHTGNML DFAIKGDAWF ALDTPAGRVL TRDGRFTIKD TGELVSIRGY       120
     PVLDAGGAPI QLNTKGGEPA VGTDGIIYQA DRQVASLGLF EADISKGYLR YENSGIMTTD       180
     QPRAVVDRFN VGVEQGYLEN SNVNAMREIT QLIEVNRAFE SVSSLMRDSE DSFKEAVQTL       240
     GGSR                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page