(data stored in ACNUC7421 zone)

EMBL: CP001622.PE346

CP001622.PE346       Location/Qualifiers
FT   CDS             357077..358477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0347"
FT                   /product="ATPase, FliI/YscN family"
FT                   /EC_number="7.1.2.2"
FT                   /note="KEGG: ret:RHE_CH00656 flagellum-specific ATP
FT                   synthase; TIGRFAM: ATPase, FliI/YscN family; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54658"
FT                   /db_xref="GOA:C6B1D9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022426"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D9"
FT                   /inference="protein motif:TFAM:TIGR01026"
FT                   /protein_id="ACS54658.1"
FT                   /translation="MSTTLLSEDGLSPKLAHLAGLVDRYASPEFAVAHGGRVQTIAAGH
FT                   YTVHGLSRHVRLGEFVAHKSATGIHLGEVVRVEPELIYVCPIEPGEPIGIHDTVIRKGA
FT                   FRIAPTDSWCGRTVNSLCEPIDGLGPIAEGLDRRSISNTAPPSMTRKRVETGFKTGVRA
FT                   IDIFSPLCLGQRLGIFAGSGVGKSTLLSMLARADAFDKVVIALVGERGREVREFIEDTL
FT                   GSNMKKAIAVVATSDESPMLRKMAPLTAVTIAEHFRDKGENVLFIIDSVTRFAHAIREV
FT                   ATASGEPPIARGYPASVFTELPRLLERAGPGPEGAGTITAIISILVDGDNHNDPIADST
FT                   RGILDGHIVLQRSLAEEGRYPPIDPLASISRLARKAWTPDQEKLVSRLKVLIHRFEETR
FT                   DLRMIGGYRQGADPDLDMAIKQVPIIYDVLKQSPGDRDSLDAFADLAGALKAAAGMGNQ
FT                   GAPIQRRG"
     MSTTLLSEDG LSPKLAHLAG LVDRYASPEF AVAHGGRVQT IAAGHYTVHG LSRHVRLGEF        60
     VAHKSATGIH LGEVVRVEPE LIYVCPIEPG EPIGIHDTVI RKGAFRIAPT DSWCGRTVNS       120
     LCEPIDGLGP IAEGLDRRSI SNTAPPSMTR KRVETGFKTG VRAIDIFSPL CLGQRLGIFA       180
     GSGVGKSTLL SMLARADAFD KVVIALVGER GREVREFIED TLGSNMKKAI AVVATSDESP       240
     MLRKMAPLTA VTIAEHFRDK GENVLFIIDS VTRFAHAIRE VATASGEPPI ARGYPASVFT       300
     ELPRLLERAG PGPEGAGTIT AIISILVDGD NHNDPIADST RGILDGHIVL QRSLAEEGRY       360
     PPIDPLASIS RLARKAWTPD QEKLVSRLKV LIHRFEETRD LRMIGGYRQG ADPDLDMAIK       420
     QVPIIYDVLK QSPGDRDSLD AFADLAGALK AAAGMGNQGA PIQRRG                      466
//

If you have problems or comments...

PBIL Back to PBIL home page