(data stored in ACNUC7421 zone)

EMBL: CP001622.PE347

CP001622.PE347       Location/Qualifiers
FT   CDS             358480..359022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54659"
FT                   /db_xref="GOA:C6B1E0"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E0"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00657"
FT                   /protein_id="ACS54659.1"
FT                   /translation="MADFDDERIASLKQRRKAAILDRFLTFAGLALAGASAFFPWYVFF
FT                   NADKFGINVASSSNSRELPDWPARNVFSVSPLAMVNKNEADKKAPPIDPLTTATVSDLG
FT                   KERDGRAIQEDQPFPGKSSFRLLHVSNGRALIEDPSGMYVVRIGSILPDESRLATLEQR
FT                   DGKWVIVTSKGETYQNN"
     MADFDDERIA SLKQRRKAAI LDRFLTFAGL ALAGASAFFP WYVFFNADKF GINVASSSNS        60
     RELPDWPARN VFSVSPLAMV NKNEADKKAP PIDPLTTATV SDLGKERDGR AIQEDQPFPG       120
     KSSFRLLHVS NGRALIEDPS GMYVVRIGSI LPDESRLATL EQRDGKWVIV TSKGETYQNN       180
//

If you have problems or comments...

PBIL Back to PBIL home page