(data stored in ACNUC7421 zone)

EMBL: CP001622.PE348

CP001622.PE348       Location/Qualifiers
FT   CDS             359289..359681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0349"
FT                   /product="flagellar basal body rod protein FlgB"
FT                   /note="KEGG: ret:RHE_CH00658 flagellar basal body rod
FT                   protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54660"
FT                   /db_xref="GOA:C6B1E1"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E1"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00658"
FT                   /protein_id="ACS54660.1"
FT                   /translation="MQPIQLFDLASRQAEWLTIRQQVVAGNIANANTPKFHAKDVTPFD
FT                   AVLDNSNINMARTNPAHLSGNDFSDSGDIDVKDAALDQEIGVQESGNTVGLAEELSKSG
FT                   DIKRQYDLNTSLVSSFNRMMLMTVRK"
     MQPIQLFDLA SRQAEWLTIR QQVVAGNIAN ANTPKFHAKD VTPFDAVLDN SNINMARTNP        60
     AHLSGNDFSD SGDIDVKDAA LDQEIGVQES GNTVGLAEEL SKSGDIKRQY DLNTSLVSSF       120
     NRMMLMTVRK                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page