(data stored in ACNUC7421 zone)

EMBL: CP001622.PE349

CP001622.PE349       Location/Qualifiers
FT   CDS             359686..360102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0350"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgC;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: ret:RHE_CH00659
FT                   flagellar basal body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54661"
FT                   /db_xref="GOA:C6B1E2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E2"
FT                   /inference="protein motif:TFAM:TIGR01395"
FT                   /protein_id="ACS54661.1"
FT                   /translation="MDPLSAAMKIAGSGLEAQSTRLRIVSENIANARSTGDTPGADPYR
FT                   RKTITFGQQMDRTNGVETVGVKKVGVDEGDFSTEFDPSNPAADPKGVVKLPNVNILVEM
FT                   ADMREANRSYDANLQTIKQTRDLISSTIDLLKSQ"
     MDPLSAAMKI AGSGLEAQST RLRIVSENIA NARSTGDTPG ADPYRRKTIT FGQQMDRTNG        60
     VETVGVKKVG VDEGDFSTEF DPSNPAADPK GVVKLPNVNI LVEMADMREA NRSYDANLQT       120
     IKQTRDLISS TIDLLKSQ                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page