(data stored in ACNUC7421 zone)

EMBL: CP001622.PE35

CP001622.PE35        Location/Qualifiers
FT   CDS             complement(32816..33382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0036"
FT                   /product="Scaffold protein Nfu/NifU"
FT                   /note="PFAM: Scaffold protein Nfu/NifU ; nitrogen-fixing
FT                   NifU domain protein; KEGG: rec:RHECIAT_CH0000421 nitrogen
FT                   fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54347"
FT                   /db_xref="GOA:C6AYC3"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC3"
FT                   /inference="protein motif:PFAM:PF08712"
FT                   /protein_id="ACS54347.1"
FT                   /translation="MFIQTEATPNPATQKFLPGKVVMENGTAEFRSTEEAQASPLAARL
FT                   FEISGVTGVYFGYDFISVSKDNADWQHLKPAILGSIMEHFMSGKPVMGDASILSEDADA
FT                   GDEFFDEGDESIVLTIKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCAGCPSS
FT                   TATLKHGVQNLLRHFVPEVQEVIAA"
     MFIQTEATPN PATQKFLPGK VVMENGTAEF RSTEEAQASP LAARLFEISG VTGVYFGYDF        60
     ISVSKDNADW QHLKPAILGS IMEHFMSGKP VMGDASILSE DADAGDEFFD EGDESIVLTI       120
     KELLETRVRP AVAQDGGDIT FRGFKDGKVY LNMKGSCAGC PSSTATLKHG VQNLLRHFVP       180
     EVQEVIAA                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page