(data stored in ACNUC7421 zone)

EMBL: CP001622.PE350

CP001622.PE350       Location/Qualifiers
FT   CDS             360105..360446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0351"
FT                   /product="flagellar hook-basal body complex protein FliE"
FT                   /note="PFAM: flagellar hook-basal body complex protein
FT                   FliE; KEGG: rec:RHECIAT_CH0000737 flagellar hook-basal body
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54662"
FT                   /db_xref="GOA:C6B1E3"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E3"
FT                   /inference="protein motif:PFAM:PF02049"
FT                   /protein_id="ACS54662.1"
FT                   /translation="MISSVQNVSNLSMTRALGAVDTENSTSSSAATMPGAAGAANGMSF
FT                   ASVMGNMASDAVSSLKGAESMSFAGIKGTATTREVVDSMLQAEQTLQTAIAIRDKVVSA
FT                   FLEVTKMQM"
     MISSVQNVSN LSMTRALGAV DTENSTSSSA ATMPGAAGAA NGMSFASVMG NMASDAVSSL        60
     KGAESMSFAG IKGTATTREV VDSMLQAEQT LQTAIAIRDK VVSAFLEVTK MQM              113
//

If you have problems or comments...

PBIL Back to PBIL home page