(data stored in ACNUC7421 zone)

EMBL: CP001622.PE351

CP001622.PE351       Location/Qualifiers
FT   CDS             360466..361254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0352"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgG;
FT                   PFAM: protein of unknown function DUF1078 domain protein;
FT                   flagellar basal body rod protein; KEGG: ret:RHE_CH00661
FT                   flagellar basal body rod protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54663"
FT                   /db_xref="GOA:C6B1E4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E4"
FT                   /inference="protein motif:TFAM:TIGR02488"
FT                   /protein_id="ACS54663.1"
FT                   /translation="MRALAIAATGMDAQQTNLEVIANNIANINTTGFKRARAEFSDLLY
FT                   QTERAKGVANRANQAVVPEGANIGLGVQTSAVRNLHLQGELTQTGNDLDVALIGKGFFQ
FT                   IQSTDGTTLYSRAGAFNKNDQGQLVTIDGYEVLPGITIPTGSTELTISRSGQVTAKLPG
FT                   ATEATELGQLTLADFVNEAGLQPLGDNLFQETPASGEAVIGNPDEEGFAYMKQGYLESS
FT                   NVDPVKEITELISAQRAYEMNSKVITTADEMASIVSKNLK"
     MRALAIAATG MDAQQTNLEV IANNIANINT TGFKRARAEF SDLLYQTERA KGVANRANQA        60
     VVPEGANIGL GVQTSAVRNL HLQGELTQTG NDLDVALIGK GFFQIQSTDG TTLYSRAGAF       120
     NKNDQGQLVT IDGYEVLPGI TIPTGSTELT ISRSGQVTAK LPGATEATEL GQLTLADFVN       180
     EAGLQPLGDN LFQETPASGE AVIGNPDEEG FAYMKQGYLE SSNVDPVKEI TELISAQRAY       240
     EMNSKVITTA DEMASIVSKN LK                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page