(data stored in ACNUC7421 zone)

EMBL: CP001622.PE352

CP001622.PE352       Location/Qualifiers
FT   CDS             361271..361753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0353"
FT                   /product="flagella basal body P-ring formation protein
FT                   FlgA"
FT                   /note="TIGRFAM: flagella basal body P-ring formation
FT                   protein FlgA; KEGG: ret:RHE_CH00662 flagellar basal body
FT                   P-ring biosynthesis protein FlgA"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54664"
FT                   /db_xref="GOA:C6B1E5"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E5"
FT                   /inference="protein motif:TFAM:TIGR03170"
FT                   /protein_id="ACS54664.1"
FT                   /translation="MMFCRAGHISGWVAAATIAVAGIFLPADVDAGMGYAVVPTTIIYP
FT                   GDTLSSSQLQEVEVTNPNLAGDYAKSISQVEGMVSKRTLLPGRTISVSGLREAYTVTRG
FT                   SSIRLVLSFGALTISAAGTPLEDGTTGQVVRARNMDSGVIVSGTVLADGTVHVRAK"
     MMFCRAGHIS GWVAAATIAV AGIFLPADVD AGMGYAVVPT TIIYPGDTLS SSQLQEVEVT        60
     NPNLAGDYAK SISQVEGMVS KRTLLPGRTI SVSGLREAYT VTRGSSIRLV LSFGALTISA       120
     AGTPLEDGTT GQVVRARNMD SGVIVSGTVL ADGTVHVRAK                             160
//

If you have problems or comments...

PBIL Back to PBIL home page