(data stored in ACNUC7421 zone)

EMBL: CP001622.PE353

CP001622.PE353       Location/Qualifiers
FT   CDS             361750..362871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0354"
FT                   /product="flagellar P-ring protein"
FT                   /note="PFAM: flagellar P-ring protein; KEGG:
FT                   rec:RHECIAT_CH0000740 flagellar basal body P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54665"
FT                   /db_xref="GOA:C6B1E6"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E6"
FT                   /inference="protein motif:PFAM:PF02119"
FT                   /protein_id="ACS54665.1"
FT                   /translation="MKLFFRFVTLVAVLAMSLADVVPAWALTSRIKDIASLQAGRDNQL
FT                   IGYGLIVGLQGTGDGFRSSPFTEQSMRAMLQNLGISTQGGQSNAKNTAAVMVTANLPPF
FT                   ASPGSRIDVTVSSLGDATSLRGGTLVMTSLSGADGQIYAVAQGAAIVSGFQAQGQAATV
FT                   TEGVTTAGRVPGGAIIERELPSRFKDSVNLVLQLRNPDFSTAIRIADIVNGYASARFGG
FT                   PVAEAKDSQEVVIQKPRTADLTRLMADIENLIVETDTPAKVVINERTGTIVIGSDVRVS
FT                   PVAVSYGTLTVQVTETPQIIQPEPFSQGRTAVQPQTDIAAEQTGGRVAIIDGPDLRTLV
FT                   AGLNNIGVKPDGIIAILQGIKSAGALQAELVLQ"
     MKLFFRFVTL VAVLAMSLAD VVPAWALTSR IKDIASLQAG RDNQLIGYGL IVGLQGTGDG        60
     FRSSPFTEQS MRAMLQNLGI STQGGQSNAK NTAAVMVTAN LPPFASPGSR IDVTVSSLGD       120
     ATSLRGGTLV MTSLSGADGQ IYAVAQGAAI VSGFQAQGQA ATVTEGVTTA GRVPGGAIIE       180
     RELPSRFKDS VNLVLQLRNP DFSTAIRIAD IVNGYASARF GGPVAEAKDS QEVVIQKPRT       240
     ADLTRLMADI ENLIVETDTP AKVVINERTG TIVIGSDVRV SPVAVSYGTL TVQVTETPQI       300
     IQPEPFSQGR TAVQPQTDIA AEQTGGRVAI IDGPDLRTLV AGLNNIGVKP DGIIAILQGI       360
     KSAGALQAEL VLQ                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page