(data stored in ACNUC7421 zone)

EMBL: CP001622.PE354

CP001622.PE354       Location/Qualifiers
FT   CDS             362868..363410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0355"
FT                   /product="putative exported flagella related protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000741 putative exported
FT                   flagella related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54666"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E7"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000741"
FT                   /protein_id="ACS54666.1"
FT                   /translation="MIDIINPDMTVLQLLRRLALPAAGLVLLSIPSAFAQEHAPAGDIT
FT                   SQDEIKQFCTNIAEPARDQRYLLQKQELEKLRADIDARMAEMDKRKAEYQDWLKRRDDF
FT                   LKQAEAGLTEIYRKMKPDAAALQLQDMKIEVASAVIMRLGPRQSSLILNEMDPEKAAVI
FT                   ASVIASASDPNTSKDPS"
     MIDIINPDMT VLQLLRRLAL PAAGLVLLSI PSAFAQEHAP AGDITSQDEI KQFCTNIAEP        60
     ARDQRYLLQK QELEKLRADI DARMAEMDKR KAEYQDWLKR RDDFLKQAEA GLTEIYRKMK       120
     PDAAALQLQD MKIEVASAVI MRLGPRQSSL ILNEMDPEKA AVIASVIASA SDPNTSKDPS       180
//

If you have problems or comments...

PBIL Back to PBIL home page