(data stored in ACNUC7421 zone)

EMBL: CP001622.PE355

CP001622.PE355       Location/Qualifiers
FT   CDS             363407..364123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0356"
FT                   /product="flagellar L-ring protein"
FT                   /note="PFAM: flagellar L-ring protein; KEGG:
FT                   rec:RHECIAT_CH0000742 flagellar L-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54667"
FT                   /db_xref="GOA:C6B1E8"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E8"
FT                   /inference="protein motif:PFAM:PF02107"
FT                   /protein_id="ACS54667.1"
FT                   /translation="MNMRFPAAIAALALLAGCQSPTAVSEIGRAPAMSPIGSGLAYGQT
FT                   PQMALYPKQPRAVAQGYSLWSDSQAALFKDARALNVGDILTVDIQINDKGSFDNETNRS
FT                   RKNSSGMNWDVNAQIFGWTPESKTDLTYGSDTSTDGKGKIERTDKLTLLVAAVVTGILE
FT                   NGNLVISGSQEVRLNQELRILNVAGIVRPQDVNAENQISYDKIAEARISYGGRGRLMEV
FT                   QQPPRGQQAVDLFSPL"
     MNMRFPAAIA ALALLAGCQS PTAVSEIGRA PAMSPIGSGL AYGQTPQMAL YPKQPRAVAQ        60
     GYSLWSDSQA ALFKDARALN VGDILTVDIQ INDKGSFDNE TNRSRKNSSG MNWDVNAQIF       120
     GWTPESKTDL TYGSDTSTDG KGKIERTDKL TLLVAAVVTG ILENGNLVIS GSQEVRLNQE       180
     LRILNVAGIV RPQDVNAENQ ISYDKIAEAR ISYGGRGRLM EVQQPPRGQQ AVDLFSPL         238
//

If you have problems or comments...

PBIL Back to PBIL home page