(data stored in ACNUC7421 zone)

EMBL: CP001622.PE356

CP001622.PE356       Location/Qualifiers
FT   CDS             364136..364642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0357"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL;
FT                   KEGG: ret:RHE_CH00666 flagellar biosynthesis transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54668"
FT                   /db_xref="GOA:C6B1E9"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E9"
FT                   /inference="protein motif:PFAM:PF03748"
FT                   /protein_id="ACS54668.1"
FT                   /translation="MAEPDASAGQSQKKSGALMTIIGIAVLTLLGAGGGWAVGTIVAPN
FT                   IKGAKEVEQAKDAEAKKKAEEGLARISTEANNVVQLEPITSNLAYPSENWVRLEVALLF
FT                   NGPPDVKVSEDIHQDILAYIRTVSLQQIEGPRGFQYLKDDIQERVDLRSQGRVSKVMFR
FT                   TFVIE"
     MAEPDASAGQ SQKKSGALMT IIGIAVLTLL GAGGGWAVGT IVAPNIKGAK EVEQAKDAEA        60
     KKKAEEGLAR ISTEANNVVQ LEPITSNLAY PSENWVRLEV ALLFNGPPDV KVSEDIHQDI       120
     LAYIRTVSLQ QIEGPRGFQY LKDDIQERVD LRSQGRVSKV MFRTFVIE                    168
//

If you have problems or comments...

PBIL Back to PBIL home page