(data stored in ACNUC7421 zone)

EMBL: CP001622.PE357

CP001622.PE357       Location/Qualifiers
FT   CDS             364639..365376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0358"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliP; PFAM:
FT                   type III secretion system inner membrane P protein; KEGG:
FT                   ret:RHE_CH00667 flagellar biosynthesis protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54669"
FT                   /db_xref="GOA:C6B1F0"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F0"
FT                   /inference="protein motif:TFAM:TIGR01103"
FT                   /protein_id="ACS54669.1"
FT                   /translation="MIRLIVFLAAMMAVPELAVAQQLPTDLLNVPVDGSVAAWIIRTFG
FT                   LLTILSVAPGILIMVTSFPRFIIAFSILRSGMGLSSTPSNMILLSLSLFMTFYVMSPTF
FT                   DQAWQNGVQPLLANQINETEAVQRIAEPFRTFMAANTRDKDLALFVDLARERGQNIQTT
FT                   DPIDYRVLIPAFMISEIRRGFEIGFLVVLPFLVIDLIVATITMAMGMMMLPPTSISLPF
FT                   KILFFVLIDGWNLLVGSLVRSFS"
     MIRLIVFLAA MMAVPELAVA QQLPTDLLNV PVDGSVAAWI IRTFGLLTIL SVAPGILIMV        60
     TSFPRFIIAF SILRSGMGLS STPSNMILLS LSLFMTFYVM SPTFDQAWQN GVQPLLANQI       120
     NETEAVQRIA EPFRTFMAAN TRDKDLALFV DLARERGQNI QTTDPIDYRV LIPAFMISEI       180
     RRGFEIGFLV VLPFLVIDLI VATITMAMGM MMLPPTSISL PFKILFFVLI DGWNLLVGSL       240
     VRSFS                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page