(data stored in ACNUC7421 zone)

EMBL: CP001622.PE358

CP001622.PE358       Location/Qualifiers
FT   CDS             complement(365518..367491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54670"
FT                   /db_xref="GOA:C6B1F1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F1"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000745"
FT                   /protein_id="ACS54670.1"
FT                   /translation="MRASAIDSHARTFPSRSWVLNSKVSFSAASKDYQMGRYTQSLATL
FT                   NQLMDIQQDAKTYALLAKNLVQLGFKADAAKAYGLAGNCEGPNSYEYQKQAAKLHYETG
FT                   NEDDALLIAMRNLTKAQEDAELAFIITAIYLKRQQRDIIRPFKTVLSQSANPDHMRLAA
FT                   LLLSDDLNDATNQNLARNIFKRFPGNLAFRFLHLVFAREFNEFEEASKHQAVIDAALAK
FT                   GDIEILRKDNPFYHLHWCGNEDFNRYATIGTTPLNQERVAFRRNQPHTWSDKIRIGYMS
FT                   SDFWDRHATMKLLQRILELHDTDRFEVTLFCHTGPEYLKHNTIDRSRWGRIVTVHGFSD
FT                   QAVLEAVREHNIDIMVDLKGHTSGSRATAFNLPLAPVHVGWLGFPGSTVNVDLDYVIGD
FT                   HFVLPEVAKPFYHEKFCRLPESYQPNDPMHRPKPRPVTREQLGLPDDAFIFASFNGNRK
FT                   ITPETIDSWCRILKRAPNSVLWLMANTPRNQANLLKQFQTAGISAKRIIFCPRAPYEQH
FT                   IDRQQAADIGIDTFPVNGHTTTSEQLWGGLPVLTVKGTNFASRVSESLLRAIDLPELVA
FT                   PDLRAYEDMAVELAENPGRIAEYKAHLKEKRYTAPLFDAERFCDHLEQAYQIMAERAKQ
FT                   GLAPDHMDIPALPPRTAPFAAE"
     MRASAIDSHA RTFPSRSWVL NSKVSFSAAS KDYQMGRYTQ SLATLNQLMD IQQDAKTYAL        60
     LAKNLVQLGF KADAAKAYGL AGNCEGPNSY EYQKQAAKLH YETGNEDDAL LIAMRNLTKA       120
     QEDAELAFII TAIYLKRQQR DIIRPFKTVL SQSANPDHMR LAALLLSDDL NDATNQNLAR       180
     NIFKRFPGNL AFRFLHLVFA REFNEFEEAS KHQAVIDAAL AKGDIEILRK DNPFYHLHWC       240
     GNEDFNRYAT IGTTPLNQER VAFRRNQPHT WSDKIRIGYM SSDFWDRHAT MKLLQRILEL       300
     HDTDRFEVTL FCHTGPEYLK HNTIDRSRWG RIVTVHGFSD QAVLEAVREH NIDIMVDLKG       360
     HTSGSRATAF NLPLAPVHVG WLGFPGSTVN VDLDYVIGDH FVLPEVAKPF YHEKFCRLPE       420
     SYQPNDPMHR PKPRPVTREQ LGLPDDAFIF ASFNGNRKIT PETIDSWCRI LKRAPNSVLW       480
     LMANTPRNQA NLLKQFQTAG ISAKRIIFCP RAPYEQHIDR QQAADIGIDT FPVNGHTTTS       540
     EQLWGGLPVL TVKGTNFASR VSESLLRAID LPELVAPDLR AYEDMAVELA ENPGRIAEYK       600
     AHLKEKRYTA PLFDAERFCD HLEQAYQIMA ERAKQGLAPD HMDIPALPPR TAPFAAE          657
//

If you have problems or comments...

PBIL Back to PBIL home page