(data stored in ACNUC7421 zone)

EMBL: CP001622.PE359

CP001622.PE359       Location/Qualifiers
FT   CDS             367922..368827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0360"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG:
FT                   ret:RHE_CH00669 flagellin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54671"
FT                   /db_xref="GOA:C6B1F2"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F2"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ACS54671.1"
FT                   /translation="MTSINTNSSAQAALQTLRSVNQNLNNTQNHVSSGYRVEKASDNAA
FT                   YWSIATTMRSDNKALSAVSDALGVGAAKVDTAYTAMDSAIDVVGDIKAKLVAATENGVD
FT                   KAKVQEEIGQLQQQLLSIAQSASFNGENWVAGADGTKSVVSSFVRDGSNAVSITTTDYV
FT                   LDSGSAGNVLFGMSGGSVETSTGILGTSSGATGSIYAMDITSFTAGQIQSALTNVEAAL
FT                   KSMTSAGAALGSLSSRIDAQDDFVSALSDSIDSGVGRLVDANMEEESSKLSALQTQQQL
FT                   AIQSLSIANSSSQNILSLFR"
     MTSINTNSSA QAALQTLRSV NQNLNNTQNH VSSGYRVEKA SDNAAYWSIA TTMRSDNKAL        60
     SAVSDALGVG AAKVDTAYTA MDSAIDVVGD IKAKLVAATE NGVDKAKVQE EIGQLQQQLL       120
     SIAQSASFNG ENWVAGADGT KSVVSSFVRD GSNAVSITTT DYVLDSGSAG NVLFGMSGGS       180
     VETSTGILGT SSGATGSIYA MDITSFTAGQ IQSALTNVEA ALKSMTSAGA ALGSLSSRID       240
     AQDDFVSALS DSIDSGVGRL VDANMEEESS KLSALQTQQQ LAIQSLSIAN SSSQNILSLF       300
     R                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page