(data stored in ACNUC7421 zone)

EMBL: CP001622.PE36

CP001622.PE36        Location/Qualifiers
FT   CDS             complement(33593..34084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0037"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: ret:RHE_CH00382
FT                   putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54348"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC4"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACS54348.1"
FT                   /translation="MVSKRLSRLEGHRRKFMAVIDGTPECQRAVHYAGRRAKNSNGGLV
FT                   LLYVIPDGDFQQWLGVEEIMRAEAREEAEAVVAKIAQIVRETIGIEPEVVIREGGAAEQ
FT                   INAVIEEDRDVAILVLAAGSAKEGPGPLVSSVAGRAAAFPIPVTVLPDTLTNEEIDALC
FT                   "
     MVSKRLSRLE GHRRKFMAVI DGTPECQRAV HYAGRRAKNS NGGLVLLYVI PDGDFQQWLG        60
     VEEIMRAEAR EEAEAVVAKI AQIVRETIGI EPEVVIREGG AAEQINAVIE EDRDVAILVL       120
     AAGSAKEGPG PLVSSVAGRA AAFPIPVTVL PDTLTNEEID ALC                         163
//

If you have problems or comments...

PBIL Back to PBIL home page