(data stored in ACNUC7421 zone)

EMBL: CP001622.PE360

CP001622.PE360       Location/Qualifiers
FT   CDS             369110..370018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0361"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG:
FT                   rec:RHECIAT_CH0000748 flagellin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54672"
FT                   /db_xref="GOA:C6B1F3"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F3"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ACS54672.1"
FT                   /translation="MTSINTNNAAMAALQTLRGINQGLQETQAHVSSGYRVGKASDNAA
FT                   YWSIATTMRSDNKALSAVSDALGLGAAKVDTAYSAMDSAIDVVGDIKAKLVAATESGVD
FT                   KAKVQEEISQLQQQLLSVAQSASFSGENWVAGADGTKNVVASFVRDGSNAVSVVMTDYV
FT                   LDSSSMGNVLFGMSVGSVETSTGILGTSNGATGSVYAMDITNFTLGEIQSALTNVESAL
FT                   KAMTSAGAQLGSISKRIELQENFVSALSDSIDSGVGRLVDANMEEESSKLSALQTQQQL
FT                   AVQSLSIANSSSQTILTLFRG"
     MTSINTNNAA MAALQTLRGI NQGLQETQAH VSSGYRVGKA SDNAAYWSIA TTMRSDNKAL        60
     SAVSDALGLG AAKVDTAYSA MDSAIDVVGD IKAKLVAATE SGVDKAKVQE EISQLQQQLL       120
     SVAQSASFSG ENWVAGADGT KNVVASFVRD GSNAVSVVMT DYVLDSSSMG NVLFGMSVGS       180
     VETSTGILGT SNGATGSVYA MDITNFTLGE IQSALTNVES ALKAMTSAGA QLGSISKRIE       240
     LQENFVSALS DSIDSGVGRL VDANMEEESS KLSALQTQQQ LAVQSLSIAN SSSQTILTLF       300
     RG                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page