(data stored in ACNUC7421 zone)

EMBL: CP001622.PE361

CP001622.PE361       Location/Qualifiers
FT   CDS             370266..371177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0362"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG:
FT                   ret:RHE_CH00671 flagellin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54673"
FT                   /db_xref="GOA:C6B1F4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F4"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ACS54673.1"
FT                   /translation="MTSILTNVAAMAALQTLRGINDSLEDTQNRVSSGYRVEKAADNAA
FT                   YWSIATTMRSDNKALSAVSDALGLGAAKVDTAYSAMDSAIDVISEIKAKIVAATEKGVD
FT                   KAKVQEEIGQLQQQLLSIAQSASFSGENWVAGADGTKSVVSSFVRDGNGNVSVKTTDYI
FT                   LDTSSTGNVLFGMDSTGAIETSSGLIGTSSGTIGSIYSMDITNFDSPEISMALTSIEAG
FT                   LEAMTKAASQLGSISTRIELQEGFVSALSDSIDSGVGRLVDANMEEESSKLSALQTQQQ
FT                   LAIQSLSIANSSAQNILTLFRS"
     MTSILTNVAA MAALQTLRGI NDSLEDTQNR VSSGYRVEKA ADNAAYWSIA TTMRSDNKAL        60
     SAVSDALGLG AAKVDTAYSA MDSAIDVISE IKAKIVAATE KGVDKAKVQE EIGQLQQQLL       120
     SIAQSASFSG ENWVAGADGT KSVVSSFVRD GNGNVSVKTT DYILDTSSTG NVLFGMDSTG       180
     AIETSSGLIG TSSGTIGSIY SMDITNFDSP EISMALTSIE AGLEAMTKAA SQLGSISTRI       240
     ELQEGFVSAL SDSIDSGVGR LVDANMEEES SKLSALQTQQ QLAIQSLSIA NSSAQNILTL       300
     FRS                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page