(data stored in ACNUC7421 zone)

EMBL: CP001622.PE362

CP001622.PE362       Location/Qualifiers
FT   CDS             371478..372440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0363"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG:
FT                   rec:RHECIAT_CH0000750 flagellin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54674"
FT                   /db_xref="GOA:C6B1F5"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F5"
FT                   /inference="protein motif:PFAM:PF00669"
FT                   /protein_id="ACS54674.1"
FT                   /translation="MTVKITSAAAVNALAVLRSINKEASQTQQQVSSGYRIETAADDAS
FT                   YWSVATVMRSDSTNLGTIGDALGLGAAKVDATYTAMDSAIDLIGEIRAKLVSAREPGAD
FT                   KDKINAEISEYKEQLQTVVESTSFAGENWLLNGDAAAPPTWQVISGFVRAPTGEYQAQT
FT                   IDFPSSQTILIDKNNASGGLLTKSVDANAINNSGATSRNYYLLNANSTTPATGTEIAIG
FT                   KNTTDAQLTDMLDVTDSLLSSLTTTAASIGVMKTRIDDQIDYTANLSDSIDKSVGALVD
FT                   TDMDEASIRQKAIETQKQMAVEAISILNTAASKILILLE"
     MTVKITSAAA VNALAVLRSI NKEASQTQQQ VSSGYRIETA ADDASYWSVA TVMRSDSTNL        60
     GTIGDALGLG AAKVDATYTA MDSAIDLIGE IRAKLVSARE PGADKDKINA EISEYKEQLQ       120
     TVVESTSFAG ENWLLNGDAA APPTWQVISG FVRAPTGEYQ AQTIDFPSSQ TILIDKNNAS       180
     GGLLTKSVDA NAINNSGATS RNYYLLNANS TTPATGTEIA IGKNTTDAQL TDMLDVTDSL       240
     LSSLTTTAAS IGVMKTRIDD QIDYTANLSD SIDKSVGALV DTDMDEASIR QKAIETQKQM       300
     AVEAISILNT AASKILILLE                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page