(data stored in ACNUC7421 zone)

EMBL: CP001622.PE363

CP001622.PE363       Location/Qualifiers
FT   CDS             372644..373273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54675"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F6"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000751"
FT                   /protein_id="ACS54675.1"
FT                   /translation="MSIALSRYLKDFGEPESSAPILDMDDFGSDAFPEMASEPAIDVEA
FT                   ERREAYAEGHAAATVELTEKYEREVRMLAEVHARELEELKLRYEVEAAAVIASRIRDIA
FT                   EEIAQLVSAGAAVAIAPVMTEALAAKAAESLASLLRDAILEGAAGAVVVRGPTRLFDIL
FT                   KAELGEHAEAVRHIETDDIDLAVEIGDAVIVTRMSAWAASLKKVLE"
     MSIALSRYLK DFGEPESSAP ILDMDDFGSD AFPEMASEPA IDVEAERREA YAEGHAAATV        60
     ELTEKYEREV RMLAEVHARE LEELKLRYEV EAAAVIASRI RDIAEEIAQL VSAGAAVAIA       120
     PVMTEALAAK AAESLASLLR DAILEGAAGA VVVRGPTRLF DILKAELGEH AEAVRHIETD       180
     DIDLAVEIGD AVIVTRMSAW AASLKKVLE                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page