(data stored in ACNUC7421 zone)

EMBL: CP001622.PE364

CP001622.PE364       Location/Qualifiers
FT   CDS             373270..374601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0365"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG:
FT                   rec:RHECIAT_CH0000752 chemotaxis motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54676"
FT                   /db_xref="GOA:C6B1F7"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F7"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ACS54676.1"
FT                   /translation="MSEGENHHHGKNEIIIVKRHGGGDHDGAHGGAWKIAYADFMTAMM
FT                   AFFLVMWLVNAANEETKASVATYFNPIKLSDEKPTEKGLKKPVDNAEGEEKQEKSKQKE
FT                   EDPNDGKAAADGDDQTSTSGDQTNYSEADFFENPYSVLAEIAQEVGQQANVSAKGDGGA
FT                   ADSGPATGADGGEAYRDPFDPDFWTKQVEVTTAGKPLPPGKSDDQAVESETTEIAKLED
FT                   AKPIPLTTDQKAAQETKETKETKGAVEAKDGKTPGGKSPEDKKAEAQKDADHQKDADKS
FT                   AAETEQQQQKEAEQLQAQIAQQIGGVAGKLAEGLTVTASEGGLLVSISDQTDDSMFNIG
FT                   SAVPRQEMVLAMEKIGAILKERGGAVAVRGHTDGRQYKGTQNENWRLSMDRAQSAYYML
FT                   VRGGLDEKRISQVSGFADRRLKLPSDPFNATNRRIEILVQADQG"
     MSEGENHHHG KNEIIIVKRH GGGDHDGAHG GAWKIAYADF MTAMMAFFLV MWLVNAANEE        60
     TKASVATYFN PIKLSDEKPT EKGLKKPVDN AEGEEKQEKS KQKEEDPNDG KAAADGDDQT       120
     STSGDQTNYS EADFFENPYS VLAEIAQEVG QQANVSAKGD GGAADSGPAT GADGGEAYRD       180
     PFDPDFWTKQ VEVTTAGKPL PPGKSDDQAV ESETTEIAKL EDAKPIPLTT DQKAAQETKE       240
     TKETKGAVEA KDGKTPGGKS PEDKKAEAQK DADHQKDADK SAAETEQQQQ KEAEQLQAQI       300
     AQQIGGVAGK LAEGLTVTAS EGGLLVSISD QTDDSMFNIG SAVPRQEMVL AMEKIGAILK       360
     ERGGAVAVRG HTDGRQYKGT QNENWRLSMD RAQSAYYMLV RGGLDEKRIS QVSGFADRRL       420
     KLPSDPFNAT NRRIEILVQA DQG                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page