(data stored in ACNUC7421 zone)

EMBL: CP001622.PE365

CP001622.PE365       Location/Qualifiers
FT   CDS             374606..375901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0366"
FT                   /product="chemotaxis motility protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000753 chemotaxis motility
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54677"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F8"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000753"
FT                   /protein_id="ACS54677.1"
FT                   /translation="MARRQHRYVGFVALGLAMLSPAGGNAQDPDDLAPYKMLRSLQFVQ
FT                   DSVVSGDHSAGEMQRFMLGTIDERLRTVDPSTFDDDRNVDAALIYAMSGGNPQTLEYLI
FT                   AHDVNGYFDNRVTDVLRKYLSGKGLLVAKTLEETAREYRDKKIGPYLALIGGNVLIATK
FT                   PTDALDLYDQARLAAPGTIVEEAALRRSVAICVDKGMLDRGMAYSQRYVRRFLHSPYAS
FT                   QFADLFVTLVVGHDHDVKPQDVIDILSFMDAPRQREVYLRIARAAAISGKPELARMAVG
FT                   RVQSLGAGTDNPFGSLADFYGGMAGLPTEDIDQAAKNVSGIDGNALSPRDQALQEAARS
FT                   VADQILRAPDPASLTQASDPNTDHQEITSEKAAAIATQPGAPGALPEPVPGGVASTGQS
FT                   QDTDPSFNAFVTTNRSKLDEIDGLLAQEGNEQ"
     MARRQHRYVG FVALGLAMLS PAGGNAQDPD DLAPYKMLRS LQFVQDSVVS GDHSAGEMQR        60
     FMLGTIDERL RTVDPSTFDD DRNVDAALIY AMSGGNPQTL EYLIAHDVNG YFDNRVTDVL       120
     RKYLSGKGLL VAKTLEETAR EYRDKKIGPY LALIGGNVLI ATKPTDALDL YDQARLAAPG       180
     TIVEEAALRR SVAICVDKGM LDRGMAYSQR YVRRFLHSPY ASQFADLFVT LVVGHDHDVK       240
     PQDVIDILSF MDAPRQREVY LRIARAAAIS GKPELARMAV GRVQSLGAGT DNPFGSLADF       300
     YGGMAGLPTE DIDQAAKNVS GIDGNALSPR DQALQEAARS VADQILRAPD PASLTQASDP       360
     NTDHQEITSE KAAAIATQPG APGALPEPVP GGVASTGQSQ DTDPSFNAFV TTNRSKLDEI       420
     DGLLAQEGNE Q                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page