(data stored in ACNUC7421 zone)

EMBL: CP001622.PE366

CP001622.PE366       Location/Qualifiers
FT   CDS             375898..377331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0367"
FT                   /product="chemotaxis motility protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000754 chemotaxis motility
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54678"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F9"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000754"
FT                   /protein_id="ACS54678.1"
FT                   /translation="MMDMSVSGGAPGAESAATAKSARPAGKDDAAGQKNGFSDALAKAS
FT                   GSAANDDADDAQPNQGVAADGSAEKAAQSIRGRNGAKPLIDLSDAALKAQAEAQPETIV
FT                   SADKAAAKPVKAEIKMPTDLGLGKLDPKDSSANGVAPAAKGGKHTKADALETDTDKASD
FT                   DDDGGISDVLGLLKQEPADGTVTLPAATAHHVSANVDEAGAADKKIDGIEAKAGGHASD
FT                   ALAAVSGNVESGKADNIKVPGSQAAEAADGKTFRISRADGRGVSMDVHIGTDQVGPKDG
FT                   SKKADVENVSVLESRRYIGLMQNSNSAAVTAALSGDSEWARAMEPSSALSNAAEWTSTG
FT                   RVVNTLKIQMNPLDLGLVTATMRLSGDALNVDLKVETGAAYRQMKEDHGKILEALRSQG
FT                   YAVENVTISMAPVERSDAGNQGQASQQQSPPQQGQGGEARERHNQTAQRTDGGFNGAGE
FT                   TGIEDARAGGSSGTGGVYL"
     MMDMSVSGGA PGAESAATAK SARPAGKDDA AGQKNGFSDA LAKASGSAAN DDADDAQPNQ        60
     GVAADGSAEK AAQSIRGRNG AKPLIDLSDA ALKAQAEAQP ETIVSADKAA AKPVKAEIKM       120
     PTDLGLGKLD PKDSSANGVA PAAKGGKHTK ADALETDTDK ASDDDDGGIS DVLGLLKQEP       180
     ADGTVTLPAA TAHHVSANVD EAGAADKKID GIEAKAGGHA SDALAAVSGN VESGKADNIK       240
     VPGSQAAEAA DGKTFRISRA DGRGVSMDVH IGTDQVGPKD GSKKADVENV SVLESRRYIG       300
     LMQNSNSAAV TAALSGDSEW ARAMEPSSAL SNAAEWTSTG RVVNTLKIQM NPLDLGLVTA       360
     TMRLSGDALN VDLKVETGAA YRQMKEDHGK ILEALRSQGY AVENVTISMA PVERSDAGNQ       420
     GQASQQQSPP QQGQGGEARE RHNQTAQRTD GGFNGAGETG IEDARAGGSS GTGGVYL          477
//

If you have problems or comments...

PBIL Back to PBIL home page