(data stored in ACNUC7421 zone)

EMBL: CP001622.PE367

CP001622.PE367       Location/Qualifiers
FT   CDS             377279..377836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0368"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   ret:RHE_CH00677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54679"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G0"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ACS54679.1"
FT                   /translation="MKTLVLAAAAVLAAFTSEATASTGACEREIQSAAAKYGIPEGILY
FT                   SVGLTETGRKGSLYPYAMNVEGKAIFPPSEQDAMRQFDVARNSGAKLIDIGCMQINHYF
FT                   HGENFRSAEEMFDPHRNVEYAAKFLRNLHDRHETWTMAVARYHAGPNNNPAQKQYVCRV
FT                   ISNLVATGYGKWTLNASNFCRN"
     MKTLVLAAAA VLAAFTSEAT ASTGACEREI QSAAAKYGIP EGILYSVGLT ETGRKGSLYP        60
     YAMNVEGKAI FPPSEQDAMR QFDVARNSGA KLIDIGCMQI NHYFHGENFR SAEEMFDPHR       120
     NVEYAAKFLR NLHDRHETWT MAVARYHAGP NNNPAQKQYV CRVISNLVAT GYGKWTLNAS       180
     NFCRN                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page