(data stored in ACNUC7421 zone)

EMBL: CP001622.PE368

CP001622.PE368       Location/Qualifiers
FT   CDS             378117..378788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0369"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: ret:RHE_CH00678 two-component response regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54680"
FT                   /db_xref="GOA:C6B1G1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G1"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ACS54680.1"
FT                   /translation="MIVVVDERELVKDGYTSLFGREGIPSTGFDPAEFGEWVQTAADSD
FT                   IAAVEAFLIGQGQRNFELPRAIRDRSMAPVIAVSDQHSLENTLALFDCGVDDVVRKPVH
FT                   PREILARAAAIRRRLKAITNYTEIGGIRVFSDGRDPEINGEVFALPRRERRILEYLIAN
FT                   RGRRVTKTQIFNAIYGIFDEEVEENVVESHISKLRKKLRKKLGVDPVDSKRFLGYCIDW
FT                   A"
     MIVVVDEREL VKDGYTSLFG REGIPSTGFD PAEFGEWVQT AADSDIAAVE AFLIGQGQRN        60
     FELPRAIRDR SMAPVIAVSD QHSLENTLAL FDCGVDDVVR KPVHPREILA RAAAIRRRLK       120
     AITNYTEIGG IRVFSDGRDP EINGEVFALP RRERRILEYL IANRGRRVTK TQIFNAIYGI       180
     FDEEVEENVV ESHISKLRKK LRKKLGVDPV DSKRFLGYCI DWA                         223
//

If you have problems or comments...

PBIL Back to PBIL home page