(data stored in ACNUC7421 zone)

EMBL: CP001622.PE369

CP001622.PE369       Location/Qualifiers
FT   CDS             378912..380210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0370"
FT                   /product="protein of unknown function DUF1078 domain
FT                   protein"
FT                   /note="PFAM: protein of unknown function DUF1078 domain
FT                   protein; flagellar basal body FlaE domain protein;
FT                   flagellar basal body rod protein; KEGG:
FT                   rec:RHECIAT_CH0000757 flagellar hook protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54681"
FT                   /db_xref="GOA:C6B1G2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G2"
FT                   /inference="protein motif:PFAM:PF06429"
FT                   /protein_id="ACS54681.1"
FT                   /translation="MSIFGSMKTAVSGMNAQANRLSTVADNIANVNTTGYKAVSTSFSS
FT                   LVLPSSGGNYNSGGVQTSVRQAVSDQGDISYTTSSTDLAISGDGFFIVQGPDGTPVLTR
FT                   AGDFTKDDEGNLVNAAGFMLMGYSYDSGSPAVVVNGFDGLVPVNVNQDGLTAIASTSGI
FT                   FKGNLDSNAKIAPVAPATLPSANLATTTTDTKKVSMVAYDRLGNKVMYDFYFTKKTVVT
FT                   PPPATPATAATWEVSMFRNADAAVGGTTSFPYSTASVGTGTLSFDANGKLTAGGAVNIV
FT                   DPVTGQTIAMDFSAFTQLGADFSGTGTPNGQAATPVKDVTVDGDGIVYAKYEDGSTKPL
FT                   YRIPLANVASPDKLTLMSGNVYSANGQSGVTVTGFPQTNGLGTIKSGALEGSNVDLAGE
FT                   LTEMIESQRSYTANSKVFQTGSDIMDVLVNLKR"
     MSIFGSMKTA VSGMNAQANR LSTVADNIAN VNTTGYKAVS TSFSSLVLPS SGGNYNSGGV        60
     QTSVRQAVSD QGDISYTTSS TDLAISGDGF FIVQGPDGTP VLTRAGDFTK DDEGNLVNAA       120
     GFMLMGYSYD SGSPAVVVNG FDGLVPVNVN QDGLTAIAST SGIFKGNLDS NAKIAPVAPA       180
     TLPSANLATT TTDTKKVSMV AYDRLGNKVM YDFYFTKKTV VTPPPATPAT AATWEVSMFR       240
     NADAAVGGTT SFPYSTASVG TGTLSFDANG KLTAGGAVNI VDPVTGQTIA MDFSAFTQLG       300
     ADFSGTGTPN GQAATPVKDV TVDGDGIVYA KYEDGSTKPL YRIPLANVAS PDKLTLMSGN       360
     VYSANGQSGV TVTGFPQTNG LGTIKSGALE GSNVDLAGEL TEMIESQRSY TANSKVFQTG       420
     SDIMDVLVNL KR                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page