(data stored in ACNUC7421 zone)

EMBL: CP001622.PE37

CP001622.PE37        Location/Qualifiers
FT   CDS             complement(34214..35278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0038"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: rec:RHECIAT_CH0000423 tryptophanyl-tRNA
FT                   synthetase protein; TIGRFAM: tryptophanyl-tRNA synthetase;
FT                   PFAM: aminoacyl-tRNA synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54349"
FT                   /db_xref="GOA:C6AYC5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC5"
FT                   /inference="protein motif:TFAM:TIGR00233"
FT                   /protein_id="ACS54349.1"
FT                   /translation="MSEFKKLVFSGVQPTGNLHLGNYLGAIRRFVALQEGNDCIYCVVD
FT                   MHALTAQLVHEDMPSQTRSIAAAFIAAGIDPEKHIVFNQSAVPQHAELAWIFNCVARIG
FT                   WMNRMTQFKDKAGKDREQASLGLYAYPSLMAADILVYRATHVPVGEDQKQHLELARDIA
FT                   MKFNLDYAEHISRTGYGVDITVGNEPVHAYFPMVEPLIGGPAPRVMSLRDGTKKMSKSD
FT                   PSDLSRINLMDDEDAISKKIRKAKTDPDGLPSEIDGLQGRPEADNLVAIYAALADKSKA
FT                   DVLAEFGGQQFSVFKPALVDLAINVLAPITGEMRRLMDDTSHIDAILRKGGERARARAE
FT                   VTMRQVRDVIGFLY"
     MSEFKKLVFS GVQPTGNLHL GNYLGAIRRF VALQEGNDCI YCVVDMHALT AQLVHEDMPS        60
     QTRSIAAAFI AAGIDPEKHI VFNQSAVPQH AELAWIFNCV ARIGWMNRMT QFKDKAGKDR       120
     EQASLGLYAY PSLMAADILV YRATHVPVGE DQKQHLELAR DIAMKFNLDY AEHISRTGYG       180
     VDITVGNEPV HAYFPMVEPL IGGPAPRVMS LRDGTKKMSK SDPSDLSRIN LMDDEDAISK       240
     KIRKAKTDPD GLPSEIDGLQ GRPEADNLVA IYAALADKSK ADVLAEFGGQ QFSVFKPALV       300
     DLAINVLAPI TGEMRRLMDD TSHIDAILRK GGERARARAE VTMRQVRDVI GFLY             354
//

If you have problems or comments...

PBIL Back to PBIL home page