(data stored in ACNUC7421 zone)

EMBL: CP001622.PE370

CP001622.PE370       Location/Qualifiers
FT   CDS             380230..381717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0371"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="TIGRFAM: flagellar hook-associated protein FlgK;
FT                   PFAM: protein of unknown function DUF1078 domain protein;
FT                   KEGG: ret:RHE_CH00680 flagellar hook-associated protein
FT                   FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54682"
FT                   /db_xref="GOA:C6B1G3"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G3"
FT                   /inference="protein motif:TFAM:TIGR02492"
FT                   /protein_id="ACS54682.1"
FT                   /translation="MSLTSALNTAQNIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTT
FT                   SLNGAQVVKIDRAQEEALLRQYLKTSSQDSAQQALLGGLEDLKSIVGGNDYETSPSTYL
FT                   GVFQQKLQAFRTTPGSTVAAQGAITAAQDVANSLNNASQSVQNVRATADKQIATDVDKL
FT                   NTLLNDFEKANNAVKTATASGADASGALDEREKALKQISQIVGVNTTTRDNNDMVLSTS
FT                   DGTILFETIPRKVTFKSQDVYTATITGNSVYVDGVALPRGSGSTTTGQGSLQSLLQVRD
FT                   EIAPNFQKQLDEVARGLVSLFKEQNTAAGPAYVPGLFTWSGGTVDTGATAVAGMAATIT
FT                   VSSRVITSQGGDPMRLRDGGVNATGLVLNTSGASGYTTELDRLYTALGSDIDFDPAAGT
FT                   PVGFDATTGIDSNVSIMEFATNSLGWLEQYRSNATTAAENTSAALSRSDEAYSNETGVN
FT                   LDEELTLLLDIEQSYKAATKILNAVDEMLKSLLDIAS"
     MSLTSALNTA QNIFNNTGTQ SSVVSNNISN AGNKDYVRRQ AMLTTSLNGA QVVKIDRAQE        60
     EALLRQYLKT SSQDSAQQAL LGGLEDLKSI VGGNDYETSP STYLGVFQQK LQAFRTTPGS       120
     TVAAQGAITA AQDVANSLNN ASQSVQNVRA TADKQIATDV DKLNTLLNDF EKANNAVKTA       180
     TASGADASGA LDEREKALKQ ISQIVGVNTT TRDNNDMVLS TSDGTILFET IPRKVTFKSQ       240
     DVYTATITGN SVYVDGVALP RGSGSTTTGQ GSLQSLLQVR DEIAPNFQKQ LDEVARGLVS       300
     LFKEQNTAAG PAYVPGLFTW SGGTVDTGAT AVAGMAATIT VSSRVITSQG GDPMRLRDGG       360
     VNATGLVLNT SGASGYTTEL DRLYTALGSD IDFDPAAGTP VGFDATTGID SNVSIMEFAT       420
     NSLGWLEQYR SNATTAAENT SAALSRSDEA YSNETGVNLD EELTLLLDIE QSYKAATKIL       480
     NAVDEMLKSL LDIAS                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page