(data stored in ACNUC7421 zone)

EMBL: CP001622.PE371

CP001622.PE371       Location/Qualifiers
FT   CDS             381721..382773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0372"
FT                   /product="flagellar hook-associated 3 family protein"
FT                   /note="PFAM: flagellar hook-associated 3 family protein;
FT                   KEGG: ret:RHE_CH00681 flagellar hook-associated protein
FT                   FlgL"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54683"
FT                   /db_xref="GOA:C6B1G4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G4"
FT                   /inference="protein motif:PFAM:PF07164"
FT                   /protein_id="ACS54683.1"
FT                   /translation="MKSSFISSSAIQNAMRLTIRQAQNQMTKATMEATTGVYADIGVSL
FT                   GGNAARSVDFSREVDRIDSIKSSNSLVTARMESSQLGLSKMKDVGDGLVSKLTALQGSH
FT                   DPGSITVAIQSATSALSTMMDTANTMVNGEYLFSGINTDVQPLTDKTTATSAAIVTELN
FT                   TYAAALVPPKAVSALTGAEMSTFITTKVEPMFSQAAWTDPTTGWSQASSQNMTSRISNS
FT                   EVIESSTNANSEGMRYFALASVMTSALLGQGLSSDAMSTVSKQAISYTTKATSGLVTQA
FT                   SQLGLSQERVKKSNDALDAQSNIIKNKLVDLQGVDPYEASTLVKTLETQLETAYTIVSK
FT                   IQQLSLVNYL"
     MKSSFISSSA IQNAMRLTIR QAQNQMTKAT MEATTGVYAD IGVSLGGNAA RSVDFSREVD        60
     RIDSIKSSNS LVTARMESSQ LGLSKMKDVG DGLVSKLTAL QGSHDPGSIT VAIQSATSAL       120
     STMMDTANTM VNGEYLFSGI NTDVQPLTDK TTATSAAIVT ELNTYAAALV PPKAVSALTG       180
     AEMSTFITTK VEPMFSQAAW TDPTTGWSQA SSQNMTSRIS NSEVIESSTN ANSEGMRYFA       240
     LASVMTSALL GQGLSSDAMS TVSKQAISYT TKATSGLVTQ ASQLGLSQER VKKSNDALDA       300
     QSNIIKNKLV DLQGVDPYEA STLVKTLETQ LETAYTIVSK IQQLSLVNYL                  350
//

If you have problems or comments...

PBIL Back to PBIL home page