(data stored in ACNUC7421 zone)

EMBL: CP001622.PE372

CP001622.PE372       Location/Qualifiers
FT   CDS             382808..383155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0373"
FT                   /product="flagellar FlaF family protein"
FT                   /note="PFAM: flagellar FlaF family protein; KEGG:
FT                   rec:RHECIAT_CH0000760 flagellin synthesis regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54684"
FT                   /db_xref="GOA:C6B1G5"
FT                   /db_xref="InterPro:IPR010845"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G5"
FT                   /inference="protein motif:PFAM:PF07309"
FT                   /protein_id="ACS54684.1"
FT                   /translation="MYQFSYAEVMQDSVADAKEREWQVLDRSIDLLAAAREKEKYGREA
FT                   IEALFYTRRVWISFIEDLKHPDNQLEIGLRANLISIAIWILKECDRIRKRQSNNYQGII
FT                   DVTTIIRDGLK"
     MYQFSYAEVM QDSVADAKER EWQVLDRSID LLAAAREKEK YGREAIEALF YTRRVWISFI        60
     EDLKHPDNQL EIGLRANLIS IAIWILKECD RIRKRQSNNY QGIIDVTTII RDGLK            115
//

If you have problems or comments...

PBIL Back to PBIL home page