(data stored in ACNUC7421 zone)

EMBL: CP001622.PE373

CP001622.PE373       Location/Qualifiers
FT   CDS             383152..383601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0374"
FT                   /product="flagellar FlbT family protein"
FT                   /note="PFAM: flagellar FlbT family protein; KEGG:
FT                   rec:RHECIAT_CH0000761 flagellin synthesis regulator
FT                   (repressor) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54685"
FT                   /db_xref="GOA:C6B1G6"
FT                   /db_xref="InterPro:IPR009967"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G6"
FT                   /inference="protein motif:PFAM:PF07378"
FT                   /protein_id="ACS54685.1"
FT                   /translation="MKSTLRISLKAGERIFINGAVLRVDRKVALEFLNDVTFLLENHVL
FT                   QPEGATTPLRQLYFIAQMILINPEGKDHSTALFRKSITMLLTCFKNEEILAELKRIDAL
FT                   VSTGRAFDALKAIRGLYAIEDNILNNHEMPPTMVEQIRREIAPWR"
     MKSTLRISLK AGERIFINGA VLRVDRKVAL EFLNDVTFLL ENHVLQPEGA TTPLRQLYFI        60
     AQMILINPEG KDHSTALFRK SITMLLTCFK NEEILAELKR IDALVSTGRA FDALKAIRGL       120
     YAIEDNILNN HEMPPTMVEQ IRREIAPWR                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page