(data stored in ACNUC7421 zone)

EMBL: CP001622.PE374

CP001622.PE374       Location/Qualifiers
FT   CDS             383592..384026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0375"
FT                   /product="flagellar hook capping protein"
FT                   /note="PFAM: flagellar hook capping protein; KEGG:
FT                   ret:RHE_CH00684 flagellar basal body rod modification
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54686"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G7"
FT                   /inference="protein motif:PFAM:PF03963"
FT                   /protein_id="ACS54686.1"
FT                   /translation="MAVDATSSVANTSSTSTTNTAQQKATLNYDNFLQLLIAQMKNQDP
FT                   TDPVDASEQMSQLASFSQVEQTIQTNTKLDTLLASSSLTQASSYVGKYMESADGTVKGT
FT                   IESVKVYSDGIIATTTDGGNILVQAGITVADKAPTTSTDT"
     MAVDATSSVA NTSSTSTTNT AQQKATLNYD NFLQLLIAQM KNQDPTDPVD ASEQMSQLAS        60
     FSQVEQTIQT NTKLDTLLAS SSLTQASSYV GKYMESADGT VKGTIESVKV YSDGIIATTT       120
     DGGNILVQAG ITVADKAPTT STDT                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page