(data stored in ACNUC7421 zone)

EMBL: CP001622.PE375

CP001622.PE375       Location/Qualifiers
FT   CDS             384126..384392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0376"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliQ; PFAM:
FT                   export protein FliQ family 3; KEGG: rec:RHECIAT_CH0000763
FT                   flagellar biosynthesis transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54687"
FT                   /db_xref="GOA:C6B1G8"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G8"
FT                   /inference="protein motif:TFAM:TIGR01402"
FT                   /protein_id="ACS54687.1"
FT                   /translation="MNEADALDLFQAAIWTVLIAAGPAVIAAMVVGLVIALIQALTQVQ
FT                   EATLTFVPKIVAVLITVGVTAPFVGSQISIFTNLVFSRIQSGF"
     MNEADALDLF QAAIWTVLIA AGPAVIAAMV VGLVIALIQA LTQVQEATLT FVPKIVAVLI        60
     TVGVTAPFVG SQISIFTNLV FSRIQSGF                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page