(data stored in ACNUC7421 zone)

EMBL: CP001622.PE376

CP001622.PE376       Location/Qualifiers
FT   CDS             384608..386695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0377"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="TIGRFAM: flagellar biosynthesis protein FlhA; PFAM:
FT                   type III secretion FHIPEP protein; KEGG: ret:RHE_CH00686
FT                   flagellar biosynthesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54688"
FT                   /db_xref="GOA:C6B1G9"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G9"
FT                   /inference="protein motif:TFAM:TIGR01398"
FT                   /protein_id="ACS54688.1"
FT                   /translation="MAQPPALPLPKVAPNLRDVGFALGIIVIICILFLPIPPFLIDMGL
FT                   AFSIALSVLILMVALWIQKPLDFSSFPTILLIATMTRLALNIATTRVILSHGHEGHDAA
FT                   GGVIAGFASLVMSGDFVIGLIVFLILITINFIVITKGATRIAEVGARFTLDAIPGKQMS
FT                   IDADLSAGIIDEREAQRRRKELEEESSFFGAMDGASKFVRGDAVAGLIITCINIFGGII
FT                   IGYFRHGMPIGEAADVFVKLSVGDGLVAQMPALIVSLAAGLLVSRGGTTGSTDQAVVNQ
FT                   LSGYPRALSVSAVLMFILALMPGLPFVPFVSLGGLLAFGAWFIPRQVEAENMLRREQEE
FT                   KKVVQSKELEKDSVKAVLRTSEIELALGKMVSTRLLGAHQELAFRVGKMRKKFATQYGF
FT                   VVPEIKVTDDIAIAEKSYQIRIHGTTVASNLLRVGEVLVVTGAGRRPSIPGDEIREPAF
FT                   GMPAVSILENFADDLKREGFQPIDNVSVVLTHMSEVIRNNLPQLLSYKDVKVLIDRLDP
FT                   EYKKLADEICSSHMSYSGLQAVLKLLLAERVSIRNLHLILEAVAELAPHVRKTEQIVEH
FT                   VRIRMAQQLCGDLADNGVLRVLRLGSKWDLAFHQALKRDAKGEVIEFDIDPRSLEEFSE
FT                   QATKVIREFMDRGLPFALVTSPETRSYVRMIIERLFATLPVLSHVELAKGIEIKILGSI
FT                   S"
     MAQPPALPLP KVAPNLRDVG FALGIIVIIC ILFLPIPPFL IDMGLAFSIA LSVLILMVAL        60
     WIQKPLDFSS FPTILLIATM TRLALNIATT RVILSHGHEG HDAAGGVIAG FASLVMSGDF       120
     VIGLIVFLIL ITINFIVITK GATRIAEVGA RFTLDAIPGK QMSIDADLSA GIIDEREAQR       180
     RRKELEEESS FFGAMDGASK FVRGDAVAGL IITCINIFGG IIIGYFRHGM PIGEAADVFV       240
     KLSVGDGLVA QMPALIVSLA AGLLVSRGGT TGSTDQAVVN QLSGYPRALS VSAVLMFILA       300
     LMPGLPFVPF VSLGGLLAFG AWFIPRQVEA ENMLRREQEE KKVVQSKELE KDSVKAVLRT       360
     SEIELALGKM VSTRLLGAHQ ELAFRVGKMR KKFATQYGFV VPEIKVTDDI AIAEKSYQIR       420
     IHGTTVASNL LRVGEVLVVT GAGRRPSIPG DEIREPAFGM PAVSILENFA DDLKREGFQP       480
     IDNVSVVLTH MSEVIRNNLP QLLSYKDVKV LIDRLDPEYK KLADEICSSH MSYSGLQAVL       540
     KLLLAERVSI RNLHLILEAV AELAPHVRKT EQIVEHVRIR MAQQLCGDLA DNGVLRVLRL       600
     GSKWDLAFHQ ALKRDAKGEV IEFDIDPRSL EEFSEQATKV IREFMDRGLP FALVTSPETR       660
     SYVRMIIERL FATLPVLSHV ELAKGIEIKI LGSIS                                  695
//

If you have problems or comments...

PBIL Back to PBIL home page