(data stored in ACNUC7421 zone)

EMBL: CP001622.PE377

CP001622.PE377       Location/Qualifiers
FT   CDS             386692..387444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0378"
FT                   /product="type III secretion system inner membrane R
FT                   protein"
FT                   /note="PFAM: type III secretion system inner membrane R
FT                   protein; KEGG: rec:RHECIAT_CH0000765 flagellar biosynthesis
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54689"
FT                   /db_xref="GOA:C6B1H0"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H0"
FT                   /inference="protein motif:PFAM:PF01311"
FT                   /protein_id="ACS54689.1"
FT                   /translation="MITDPQGTVLALFLVFCRIGGCVLALPGFSSARVPDQLRVFIAGA
FT                   LSIAVMPLLWDTVYPAVHTGAGTYIGLIFSESLIGVMYGMLARIYTLGMQFAATIIAMM
FT                   VGYTQPGSADILEDTPETSLSGFITFAGMMILFIMDFHHIVFRALIDSYTTMPFGGLMQ
FT                   MRATLISFTDTLEQTTYIMLRLSSPFLIYGLIFNVSIGFINKLAPQIPVYFISTPYLLM
FT                   GGLFLIYFSIAAMVSQFGQSFGSIYIGR"
     MITDPQGTVL ALFLVFCRIG GCVLALPGFS SARVPDQLRV FIAGALSIAV MPLLWDTVYP        60
     AVHTGAGTYI GLIFSESLIG VMYGMLARIY TLGMQFAATI IAMMVGYTQP GSADILEDTP       120
     ETSLSGFITF AGMMILFIMD FHHIVFRALI DSYTTMPFGG LMQMRATLIS FTDTLEQTTY       180
     IMLRLSSPFL IYGLIFNVSI GFINKLAPQI PVYFISTPYL LMGGLFLIYF SIAAMVSQFG       240
     QSFGSIYIGR                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page