(data stored in ACNUC7421 zone)

EMBL: CP001622.PE378

CP001622.PE378       Location/Qualifiers
FT   CDS             387452..387865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54690"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H1"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000766"
FT                   /protein_id="ACS54690.1"
FT                   /translation="MIEKKRSQKLKRLLSVQRHIERMAENDLAETSRQRVEVNVAMDDV
FT                   ILALGSMDPVHHAFSQNYADRFGRLTIKDQQLTGMHQIHEMRLTRERAKGDRLEEGMQE
FT                   ALEAERREADDNAVYDVIDQQFATPASSKLQKP"
     MIEKKRSQKL KRLLSVQRHI ERMAENDLAE TSRQRVEVNV AMDDVILALG SMDPVHHAFS        60
     QNYADRFGRL TIKDQQLTGM HQIHEMRLTR ERAKGDRLEE GMQEALEAER READDNAVYD       120
     VIDQQFATPA SSKLQKP                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page