(data stored in ACNUC7421 zone)

EMBL: CP001622.PE379

CP001622.PE379       Location/Qualifiers
FT   CDS             387898..388461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54691"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H2"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000767"
FT                   /protein_id="ACS54691.1"
FT                   /translation="MAISPPSDLVLDVVKAADPMELQAAQEKLKANRAAFAATSLAENG
FT                   KGFSNTVDVLDQVGHKSGLNNIQNRTKAEEAPESYRKFEAMVLQNFVKSMLPSESEDVY
FT                   GKGATGDIWKGMMAEQLGNVMAKGDGIGIAKQMYSEQLRRQEGKIVNASTDDDDRNTAL
FT                   SMIDDFQRKTFGTPTAEAKTDRTG"
     MAISPPSDLV LDVVKAADPM ELQAAQEKLK ANRAAFAATS LAENGKGFSN TVDVLDQVGH        60
     KSGLNNIQNR TKAEEAPESY RKFEAMVLQN FVKSMLPSES EDVYGKGATG DIWKGMMAEQ       120
     LGNVMAKGDG IGIAKQMYSE QLRRQEGKIV NASTDDDDRN TALSMIDDFQ RKTFGTPTAE       180
     AKTDRTG                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page