(data stored in ACNUC7421 zone)

EMBL: CP001622.PE380

CP001622.PE380       Location/Qualifiers
FT   CDS             388586..388951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54692"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H3"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00690"
FT                   /protein_id="ACS54692.1"
FT                   /translation="MEIVSNEYRIKSVLGRLEMIIDNENTRIGNDPQFDLKVSNAHKSR
FT                   CLYELSTLFRDTDPAELAAAHLDQLHGLKKKLVLNARRVEAHLEAVRAVADLLKNAVQD
FT                   ADADGTYSQEQFAARGN"
     MEIVSNEYRI KSVLGRLEMI IDNENTRIGN DPQFDLKVSN AHKSRCLYEL STLFRDTDPA        60
     ELAAAHLDQL HGLKKKLVLN ARRVEAHLEA VRAVADLLKN AVQDADADGT YSQEQFAARG       120
     N                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page