(data stored in ACNUC7421 zone)

EMBL: CP001622.PE381

CP001622.PE381       Location/Qualifiers
FT   CDS             388951..389490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54693"
FT                   /db_xref="GOA:C6B1H4"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H4"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00691"
FT                   /protein_id="ACS54693.1"
FT                   /translation="MIKLVLTGVWVCAITLASVYFSVYLATAPAPAATDSKQSALELVK
FT                   GETITVPIIGNGAITGYFLGRVSFMMNKDMLKGVTLPLSEMTTDELFSLLVGNKMVDIA
FT                   HIKSFDPKAFREEIKKGMNERLGGEYVADVMLEQLDYLSKEEVKESSAGQPKKVGKPVK
FT                   IVETAPAAEAPAPAAH"
     MIKLVLTGVW VCAITLASVY FSVYLATAPA PAATDSKQSA LELVKGETIT VPIIGNGAIT        60
     GYFLGRVSFM MNKDMLKGVT LPLSEMTTDE LFSLLVGNKM VDIAHIKSFD PKAFREEIKK       120
     GMNERLGGEY VADVMLEQLD YLSKEEVKES SAGQPKKVGK PVKIVETAPA AEAPAPAAH        179
//

If you have problems or comments...

PBIL Back to PBIL home page