(data stored in ACNUC7421 zone)

EMBL: CP001622.PE382

CP001622.PE382       Location/Qualifiers
FT   CDS             389782..390621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0383"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF; KEGG:
FT                   rec:RHECIAT_CH0000770 N-acetyl mannosamine transferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54694"
FT                   /db_xref="GOA:C6B1H5"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H5"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ACS54694.1"
FT                   /translation="MNLIANFAVLASRRTIFDLPVCDLGWDDALVFINELASIPVGQTV
FT                   VCFVNAHNMLTALRDDEYYRIMSHNLVLPDGIGLNIASQIAHGSPFPANLNGTDFVPAF
FT                   LTFMEAPRRIGLIGGERSVVEAAAENFRRHTPWHEFVVVSDGYFDKVDPTDVIEELERQ
FT                   KVDILIVGMGTPLQEKWVHDHIRADHARLVLTVGALFDFVSGAVPRAPRTVRMMRLEWA
FT                   YRLLQEPTRLWRRYIIGIPVFLFHVLRYRFRRRERILSHPEEHGSALQPRSDHKKAS"
     MNLIANFAVL ASRRTIFDLP VCDLGWDDAL VFINELASIP VGQTVVCFVN AHNMLTALRD        60
     DEYYRIMSHN LVLPDGIGLN IASQIAHGSP FPANLNGTDF VPAFLTFMEA PRRIGLIGGE       120
     RSVVEAAAEN FRRHTPWHEF VVVSDGYFDK VDPTDVIEEL ERQKVDILIV GMGTPLQEKW       180
     VHDHIRADHA RLVLTVGALF DFVSGAVPRA PRTVRMMRLE WAYRLLQEPT RLWRRYIIGI       240
     PVFLFHVLRY RFRRRERILS HPEEHGSALQ PRSDHKKAS                              279
//

If you have problems or comments...

PBIL Back to PBIL home page