(data stored in ACNUC7421 zone)

EMBL: CP001622.PE383

CP001622.PE383       Location/Qualifiers
FT   CDS             390778..392550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0384"
FT                   /product="putative succinoglycan biosynthesis transport
FT                   protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000771 putative succinoglycan
FT                   biosynthesis transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54695"
FT                   /db_xref="GOA:C6B1H6"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H6"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000771"
FT                   /protein_id="ACS54695.1"
FT                   /translation="MYDIRARNNFQDRVAAGPRHDDDSYGAPRSRQPDIAPPEAELLRA
FT                   IGRVLEEQRARAARTAPLVDRIETILGNRLRAANDVGHLLLQQPAGDEELSVPADEPMI
FT                   SPEPLAAVREEPAAARSVAPRRRVGGIGLVMMVAAATIVGAGLPAQMPASPALYRAEAT
FT                   LAVKSDAASRAAFTQAAAKGLLSARVVASTVAALKLDHDPEFAGASANALGVALDLLSA
FT                   TGAAADPASRAEATLKHAVEILPDAAAGTILVRATTGNSGKSMRIAAKLAEAVSAADGP
FT                   GGNVETDTALRKTYDEVKVELAAFTAKSGEGNVKVAIDLRRQIDQLDADLKAADQNILA
FT                   AKAQTDRLKAAKLAEVLDGSLPSDMLSPALQDWRDKYAVAKTTLAQLSAELGPRHPRLL
FT                   QQQAETDGLKENMGKELTRLAQTANLAAKAAVDARKGLNDRRNTLIAQSRDTGVDLSRL
FT                   TELSEKANAARSRLEEATSTAVETAADGRIVLLKPALATAVSGSDGLTGRSLAGAAAGL
FT                   AIGLAAAFLLRLRRPVADPAREKMPVLRPQAALPSMPAQAPAPVDEMELLRSEISGLRD
FT                   RLRVHALEARQPLR"
     MYDIRARNNF QDRVAAGPRH DDDSYGAPRS RQPDIAPPEA ELLRAIGRVL EEQRARAART        60
     APLVDRIETI LGNRLRAAND VGHLLLQQPA GDEELSVPAD EPMISPEPLA AVREEPAAAR       120
     SVAPRRRVGG IGLVMMVAAA TIVGAGLPAQ MPASPALYRA EATLAVKSDA ASRAAFTQAA       180
     AKGLLSARVV ASTVAALKLD HDPEFAGASA NALGVALDLL SATGAAADPA SRAEATLKHA       240
     VEILPDAAAG TILVRATTGN SGKSMRIAAK LAEAVSAADG PGGNVETDTA LRKTYDEVKV       300
     ELAAFTAKSG EGNVKVAIDL RRQIDQLDAD LKAADQNILA AKAQTDRLKA AKLAEVLDGS       360
     LPSDMLSPAL QDWRDKYAVA KTTLAQLSAE LGPRHPRLLQ QQAETDGLKE NMGKELTRLA       420
     QTANLAAKAA VDARKGLNDR RNTLIAQSRD TGVDLSRLTE LSEKANAARS RLEEATSTAV       480
     ETAADGRIVL LKPALATAVS GSDGLTGRSL AGAAAGLAIG LAAAFLLRLR RPVADPAREK       540
     MPVLRPQAAL PSMPAQAPAP VDEMELLRSE ISGLRDRLRV HALEARQPLR                  590
//

If you have problems or comments...

PBIL Back to PBIL home page