(data stored in ACNUC7421 zone)

EMBL: CP001622.PE384

CP001622.PE384       Location/Qualifiers
FT   CDS             392669..393568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0385"
FT                   /product="Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="PFAM: tetrahydrofolate dehydrogenase/cyclohydrolase;
FT                   KEGG: rec:RHECIAT_CH0000772 folD1"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54696"
FT                   /db_xref="GOA:C6B1H7"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H7"
FT                   /inference="protein motif:PRIAM:3.5.4.9"
FT                   /protein_id="ACS54696.1"
FT                   /translation="MTTVIDGKNVAASVIQTVKSATAALEKSSGVTTGLAVVIVGDDPA
FT                   SHAYVGSKGRMAKECGFKSVQHTLPAETKQEDLAALVASLNADPSIHGILVQLPLPKPL
FT                   DSEAIIQSILPEKDVDGLSVVNAGKLATGDLKTGLVSCTPAGAMVFVRRTHGEDLSGLN
FT                   AVVIGRSNLFGKPMAQLLLNANATVTIAHSRTKNLAEVCRNADILVAAVGRPEMVRADW
FT                   VKPGATVIDVGINRVAAPERGEGKTRLVGDVAFEEVSAVASTITPVPGGVGPMTIAMLM
FT                   ANTVIAAHRTAGQTPPQF"
     MTTVIDGKNV AASVIQTVKS ATAALEKSSG VTTGLAVVIV GDDPASHAYV GSKGRMAKEC        60
     GFKSVQHTLP AETKQEDLAA LVASLNADPS IHGILVQLPL PKPLDSEAII QSILPEKDVD       120
     GLSVVNAGKL ATGDLKTGLV SCTPAGAMVF VRRTHGEDLS GLNAVVIGRS NLFGKPMAQL       180
     LLNANATVTI AHSRTKNLAE VCRNADILVA AVGRPEMVRA DWVKPGATVI DVGINRVAAP       240
     ERGEGKTRLV GDVAFEEVSA VASTITPVPG GVGPMTIAML MANTVIAAHR TAGQTPPQF        299
//

If you have problems or comments...

PBIL Back to PBIL home page