(data stored in ACNUC7421 zone)

EMBL: CP001622.PE385

CP001622.PE385       Location/Qualifiers
FT   CDS             complement(393619..394644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0386"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI;
FT                   KEGG: rec:RHECIAT_CH0000773 transcriptional regulator
FT                   protein, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54697"
FT                   /db_xref="GOA:C6B1H8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H8"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACS54697.1"
FT                   /translation="MNLKQLSELLGLSQTTVSRALNGYPEVNEATRERVLQAVKETGYR
FT                   PNKAAQRLATGKAGSIGLVMPTAPGHQSDVHFGEFLAGLGEEAVRHDFHFVIMPADPDD
FT                   EVAALRRLAISGNVDALFVAYMRGHDPRLAMLKSLSMPYVVHGRSFGSEPDYPYLDIDN
FT                   EGAFYDATRLLLQLGHTRFALMNGPMHLDFAIRRKNGVVAALAERGLALEEGCMSHALM
FT                   TDEQGLLAMEHFLQLPERPTAILCSSTVLALGAIRAVNQAGLRLGEDISLIAHDDVLPL
FT                   LKPESFSVPLTTTRSSLRAAGVRIAQRLIGTVKQAGPFPDQELWKTELIVRASTGPVPQ
FT                   A"
     MNLKQLSELL GLSQTTVSRA LNGYPEVNEA TRERVLQAVK ETGYRPNKAA QRLATGKAGS        60
     IGLVMPTAPG HQSDVHFGEF LAGLGEEAVR HDFHFVIMPA DPDDEVAALR RLAISGNVDA       120
     LFVAYMRGHD PRLAMLKSLS MPYVVHGRSF GSEPDYPYLD IDNEGAFYDA TRLLLQLGHT       180
     RFALMNGPMH LDFAIRRKNG VVAALAERGL ALEEGCMSHA LMTDEQGLLA MEHFLQLPER       240
     PTAILCSSTV LALGAIRAVN QAGLRLGEDI SLIAHDDVLP LLKPESFSVP LTTTRSSLRA       300
     AGVRIAQRLI GTVKQAGPFP DQELWKTELI VRASTGPVPQ A                           341
//

If you have problems or comments...

PBIL Back to PBIL home page