(data stored in ACNUC7421 zone)

EMBL: CP001622.PE386

CP001622.PE386       Location/Qualifiers
FT   CDS             394953..396314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0387"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ret:RHE_CH00696 alpha-glucoside ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54698"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS54698.1"
FT                   /translation="MKKSFLMGVAVAALFAGAASAADLKFAPGQDSKFNWKSYDEFKAA
FT                   HADLKGQPLTIFGPWRGEDEAFFMSVLAYFTEATGIDAKYSSSENYEQQIVIDTQAGSP
FT                   PNIAVLPQPGLLADLASKGFLTPLGDDNSKWIKDNYGAGDSWVGYGTYKGKDGKEAFYA
FT                   FPYKADVKSLVWYVPENFEEAGYKIPTTMEELHALTDQIVKDGGVPWCIGLGSGGATGW
FT                   PATDWVEDIMLRMQPPEAYDKWTTNELKFTDPAVVAAIDEFGKFAKNAKYVDGGVAAVA
FT                   STDFRDSPKGLFAVPPKCYMHHQASFIPSFFPEGTKLGQDADFFYMPTFASHPELGKPV
FT                   LGAGTLVSIAKDSKTARAFIDFLKTPIAHEVWMAQSSFLTPYKGVSTEAYANPQMKKEG
FT                   DILTSATTFRFDGSDLMPGKIGAGAFWTGMVDFVGGKSAEEAAGEIQSAWDGIK"
     MKKSFLMGVA VAALFAGAAS AADLKFAPGQ DSKFNWKSYD EFKAAHADLK GQPLTIFGPW        60
     RGEDEAFFMS VLAYFTEATG IDAKYSSSEN YEQQIVIDTQ AGSPPNIAVL PQPGLLADLA       120
     SKGFLTPLGD DNSKWIKDNY GAGDSWVGYG TYKGKDGKEA FYAFPYKADV KSLVWYVPEN       180
     FEEAGYKIPT TMEELHALTD QIVKDGGVPW CIGLGSGGAT GWPATDWVED IMLRMQPPEA       240
     YDKWTTNELK FTDPAVVAAI DEFGKFAKNA KYVDGGVAAV ASTDFRDSPK GLFAVPPKCY       300
     MHHQASFIPS FFPEGTKLGQ DADFFYMPTF ASHPELGKPV LGAGTLVSIA KDSKTARAFI       360
     DFLKTPIAHE VWMAQSSFLT PYKGVSTEAY ANPQMKKEGD ILTSATTFRF DGSDLMPGKI       420
     GAGAFWTGMV DFVGGKSAEE AAGEIQSAWD GIK                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page