(data stored in ACNUC7421 zone)

EMBL: CP001622.PE387

CP001622.PE387       Location/Qualifiers
FT   CDS             396503..397516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0388"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_CH00697
FT                   alpha-glucoside ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54699"
FT                   /db_xref="GOA:C6B1I0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54699.1"
FT                   /translation="MLSQIVSALGVVVGAVIACSAYFYFSNKILDLALPVKDGDIRAAS
FT                   RNLNRRALVRPWLFIGPALFLLVVYLVYPVVATFILSFYDRAGLQFVGLANYKWALGDR
FT                   EFRQSIFNNILWLAVVPAACTFFGLVIAVMTDRIWWGNIAKSIVFMPMAISFVGASVIW
FT                   KFIYEYRGGNDVQIGLLNAIVQTFGGTPEVWISIPFWNNFFLMIILIWIQTGFAMVILS
FT                   AALRGIPEETIEAAVIDGANGWQIFWRIMVPQVWGSIAVVWTTITILVLKVFDIVLTMT
FT                   NGQWQTMVLANLMFDWMFRGGGDSGRSAVIAIIIMLAVTPIMVWNVRRANRELKGH"
     MLSQIVSALG VVVGAVIACS AYFYFSNKIL DLALPVKDGD IRAASRNLNR RALVRPWLFI        60
     GPALFLLVVY LVYPVVATFI LSFYDRAGLQ FVGLANYKWA LGDREFRQSI FNNILWLAVV       120
     PAACTFFGLV IAVMTDRIWW GNIAKSIVFM PMAISFVGAS VIWKFIYEYR GGNDVQIGLL       180
     NAIVQTFGGT PEVWISIPFW NNFFLMIILI WIQTGFAMVI LSAALRGIPE ETIEAAVIDG       240
     ANGWQIFWRI MVPQVWGSIA VVWTTITILV LKVFDIVLTM TNGQWQTMVL ANLMFDWMFR       300
     GGGDSGRSAV IAIIIMLAVT PIMVWNVRRA NRELKGH                                337
//

If you have problems or comments...

PBIL Back to PBIL home page