(data stored in ACNUC7421 zone)

EMBL: CP001622.PE388

CP001622.PE388       Location/Qualifiers
FT   CDS             397518..398681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0389"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000777
FT                   alpha-glucoside ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54700"
FT                   /db_xref="GOA:C6B1I1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54700.1"
FT                   /translation="MTAIGSYFKIGPARLFVHAAVLLIVIIWLIPTLGIFVSALRDKDQ
FT                   IVVSGWWTAFVGSTQTAAVRLGTPDQQKQEGATYVISGNVLEGQTGRAVKAFGNRIQQP
FT                   AAFKAGETADLGDGETLQINSDGSYRYVKNAAFSPDQRPKRIYASVSAPPEFTMQNYNT
FT                   VLTGEGIGQSFINSLTVTIPATIIPILIAAFAAYALSWMEFPGRGLLIALVVGLIVVPL
FT                   QMSLIPLLRLYNEIGNMLGQPSKTYPGIWLAHTAFGMPLAIYLLRAYIAGLPKEIIESA
FT                   RVDGASDFEIFVRIVLPLSFPALASFAIFQFLWVWNDLLVAMVFLGTDKDHIVLTGSLN
FT                   ALLGSRGGNWEILTASAFVTIIVPLLVFFGLQRYLVRGLLAGSVKGG"
     MTAIGSYFKI GPARLFVHAA VLLIVIIWLI PTLGIFVSAL RDKDQIVVSG WWTAFVGSTQ        60
     TAAVRLGTPD QQKQEGATYV ISGNVLEGQT GRAVKAFGNR IQQPAAFKAG ETADLGDGET       120
     LQINSDGSYR YVKNAAFSPD QRPKRIYASV SAPPEFTMQN YNTVLTGEGI GQSFINSLTV       180
     TIPATIIPIL IAAFAAYALS WMEFPGRGLL IALVVGLIVV PLQMSLIPLL RLYNEIGNML       240
     GQPSKTYPGI WLAHTAFGMP LAIYLLRAYI AGLPKEIIES ARVDGASDFE IFVRIVLPLS       300
     FPALASFAIF QFLWVWNDLL VAMVFLGTDK DHIVLTGSLN ALLGSRGGNW EILTASAFVT       360
     IIVPLLVFFG LQRYLVRGLL AGSVKGG                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page