(data stored in ACNUC7421 zone)

EMBL: CP001622.PE389

CP001622.PE389       Location/Qualifiers
FT   CDS             398715..400367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0390"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: ret:RHE_CH00699
FT                   alpha-glucosidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54701"
FT                   /db_xref="GOA:C6B1I2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I2"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACS54701.1"
FT                   /translation="MNVASQSISTPDKDWWRGAVIYQIYPRSYQDSNGDGIGDLKGITA
FT                   RLPHVANLGVDAIWISPFFTSPMRDFGYDVSDYENVDSIFGTLVDFDTMIAEAHRLGIR
FT                   VMIDLVISHSSDQHPWFAQSRSSKTNAKADWYVWADAKPDGTPPNNWLSIFGGSAWAWD
FT                   PTRMQYYLHNFLTSQPDMNLHNPEVQDRLLDVVRFWLNRGVDGFRLDTINFYFHDTQLR
FT                   DNPALAPERRNASTAPAVNPYNFQEHLYDKNRPENLAFLKRFRAVLEEFPAIAAVGEVG
FT                   DSQRGLEIVGEYTSGNDKMHMCYAFEFLAPDPLTPERVEEVMQDFEAAAPDGWACWAFS
FT                   NHDVMRHVSRWGGLVADHDAFAKLYASLLMTLRGSVCLYQGEELALTEADLAYQDLQDP
FT                   YGIQFWPEFKGRDGCRTPMVWDSQVAQGGFSTVKPWLPVPVEHILRAVSVQLGDEASVL
FT                   EHYRRFIAFRKLHPAFAKGEIEFEEQQADSLVFTREYGNEKLLCIFNMSPAEAAVILPA
FT                   GEWQALTGHGFTSNNYGDKIDIPAWGAYFARLA"
     MNVASQSIST PDKDWWRGAV IYQIYPRSYQ DSNGDGIGDL KGITARLPHV ANLGVDAIWI        60
     SPFFTSPMRD FGYDVSDYEN VDSIFGTLVD FDTMIAEAHR LGIRVMIDLV ISHSSDQHPW       120
     FAQSRSSKTN AKADWYVWAD AKPDGTPPNN WLSIFGGSAW AWDPTRMQYY LHNFLTSQPD       180
     MNLHNPEVQD RLLDVVRFWL NRGVDGFRLD TINFYFHDTQ LRDNPALAPE RRNASTAPAV       240
     NPYNFQEHLY DKNRPENLAF LKRFRAVLEE FPAIAAVGEV GDSQRGLEIV GEYTSGNDKM       300
     HMCYAFEFLA PDPLTPERVE EVMQDFEAAA PDGWACWAFS NHDVMRHVSR WGGLVADHDA       360
     FAKLYASLLM TLRGSVCLYQ GEELALTEAD LAYQDLQDPY GIQFWPEFKG RDGCRTPMVW       420
     DSQVAQGGFS TVKPWLPVPV EHILRAVSVQ LGDEASVLEH YRRFIAFRKL HPAFAKGEIE       480
     FEEQQADSLV FTREYGNEKL LCIFNMSPAE AAVILPAGEW QALTGHGFTS NNYGDKIDIP       540
     AWGAYFARLA                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page